Skip to main content

Table 1 Amino acid sequences of conserved fragments of M2 and HA2–2 fragments from human and avian influenza A viruses

From: Flagellin-fused protein targeting M2e and HA2 induces potent humoral and T-cell responses and protects mice against various influenza viruses a subtypes

Epitopes Amino acid sequence
consensus M2e of human influenza A viruses SLLTEVETPIRNEWGCRCNDSSD
M2e of A/California/07/09 (H1N1pdm09) SLLTEVETPTRSEWECRCSDSSD
M2e of A/Aichi/2/68 (H3N2) SLLTEVETPIRNEWGCRCNDSSD
M2e of A/Shanghai/2/2013 -PR8-IDCDC(H7N9) SLLTEVETPTRTGWECNCSGSSE
HA2–2(76–130) consensus for influenza viruses A/H3N2 RIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFE R TR K QLRENA
HA2–2(76–130) consensus for influenza viruses A/H7N9 from birds and humans Q I GNVINWTR D SMTEV WSYNAELLVA M ENQHTIDL A DSEMNKL Y ER VKR QLRENA
HA2–2-(76–130) consensus for influenza viruses A/H3N2 and A/H7N9 RIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFEKTRRQLRENA
  1. Residues that differ between the sequences are displayed in bold font and underlined